PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009588830.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Nin-like
Protein Properties Length: 1001aa    MW: 109480 Da    PI: 5.9405
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009588830.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK91.85.1e-29595646152
          RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                     aek++sl++l++yFs+++kdAAk++gvc+T+LKriCRq+GI+RWP+Rki+++
  XP_009588830.1 595 AEKHVSLSVLQQYFSGSLKDAAKSIGVCPTTLKRICRQHGISRWPSRKINKV 646
                     5899**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.188578666IPR003035RWP-RK domain
PfamPF020424.2E-26599646IPR003035RWP-RK domain
SuperFamilySSF542773.6E-22898984No hitNo description
SMARTSM006661.1E-23901983IPR000270PB1 domain
PfamPF005647.6E-19901982IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2401.1E-24901983No hitNo description
PROSITE profilePS5174520.581901983IPR000270PB1 domain
CDDcd064073.54E-33902982No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1001 aa     Download sequence    Send to blast
MERGVGLWAS PRGQMEGVVA FDAGARSSNV DDSFNNVMEI MNLDAYTGWC TSPSAAEQMF  60
ASYAAFSQIN SMSQSYAPFE GLSYTEQNTG TFPPMDANMV GSTVCGGEKM MFGQNDGQLH  120
FVVDSTDGVG LVAKRSKNSS QQADDADIDN SMIVRSPSQP LAERMLRALA MFKESSGAGI  180
LAQVWIPMKN KDRYILSTCE QPYLLDQALS GYREVSRKFT FDAETKPGSI PGLPGRVFSS  240
RIPEWTSNVL YYKEAEYLRV QYAVNHEVRG SIALPVFEDD ACETPCCAVL ELVTMKEKPN  300
FDLEMDHVCR ALKAVNLRSI APPRLHSQSL SKNQRAALAE ITDVLRAVCH AHKLPLALTW  360
IPCSVTEGEG DESIRVLARG CNASSNEKCV LCAEDTACYA SDKEMQGFVH ACMEHYLEEG  420
EGIVGKALQS NHPFFYPDVK EYHISEYPLV HHARKFGLNA AVAIRLRSTF TGNDDYILEF  480
FLPISMKGST EQQLLLNNLS GTMQRICRSL RTVSDAELVG QGATFGLQDG FAPNLPPITL  540
SRRNSQHSLD SNSNSVSVAP LGVSDSKSAG MQADGSREQT MIGSRRQMEK KRSTAEKHVS  600
LSVLQQYFSG SLKDAAKSIG VCPTTLKRIC RQHGISRWPS RKINKVNRSL KKIQTVLESV  660
QGVEGGLKFD PATGGLVPAS FIIQDFDAQQ SIFFPCKDVS VKNPNSVFQD AVSVPSTSGI  720
DKENSMVKME EDSYVDGNQL GQSNYINTSS FKGGNKSSIP VSGFCYEPKL AALDAMSSRP  780
ASRTMPLTNS RNASLGSFHT KEGCRRWGLD NDTLDNFECH FTSRCSYSKA AGGDGDTKMK  840
GDNEMDGDGG VIEHNQASSS AMTDSSNGSE SMMNGSSSSS RSRGARNHSK VEANFGDSGS  900
TITVKATYKE DTTRFKFEPS AGCFQLYEEV AKRFKLQTGT FQLKYLDDEE EWVMLVNDAD  960
LHECLEILDF VGGRTIKFLV RDTPYAMGSS GSSNCLLGSG S
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754500.0HG975450.1 Solanum pennellii chromosome ch11, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009588830.10.0PREDICTED: protein NLP9-like
RefseqXP_009588831.10.0PREDICTED: protein NLP9-like
RefseqXP_009588832.10.0PREDICTED: protein NLP9-like
RefseqXP_009588834.10.0PREDICTED: protein NLP9-like
SwissprotO228640.0NLP8_ARATH; Protein NLP8
TrEMBLM1B0930.0M1B093_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000341880.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA39812445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43500.20.0Nin-like family protein